PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 185aa    MW: 21269.6 Da    PI: 8.1079
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23525.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-13243748
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
       KHN23525.1  2 EEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYL 43
                     9***************************************97 PP

2Myb_DNA-binding56.65.8e-184992146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T+eE++l++++++++G++ W++Ia++++ gRt++++k++w++
       KHN23525.1 49 RGNITPEEQLLIIELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 92
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.788143IPR017930Myb domain
SuperFamilySSF466896.25E-26290IPR009057Homeodomain-like
CDDcd001672.40E-8243No hitNo description
Gene3DG3DSA:1.10.10.602.0E-19250IPR009057Homeodomain-like
PfamPF002496.3E-12243IPR001005SANT/Myb domain
SMARTSM007174.9E-5245IPR001005SANT/Myb domain
PROSITE profilePS5129425.6414498IPR017930Myb domain
SMARTSM007172.5E-164896IPR001005SANT/Myb domain
PfamPF002498.4E-174992IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-255198IPR009057Homeodomain-like
CDDcd001673.73E-135392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MEEDLILINY IANHGEGVWN SLAKASGLKR TGKSCRLRWL NYLRPDVRRG NITPEEQLLI  60
IELHAKWGNR WSKIAKHLPG RTDNEIKNFW RTRIQKHIKQ AETSQQHGNS SENSNNDHQA  120
SNSTSKVSTM AHPNETFSPP SYQATFEPFQ PQFPTINDQS SCCTSNNNYW SIEDIWSSMQ  180
LLNGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2029813108B-MYB
1h8a_C1e-2029833128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0898410.0BT089841.1 Soybean clone JCVI-FLGm-2P22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553814.11e-137PREDICTED: myb-related protein 305
SwissprotQ9LK955e-82MYB21_ARATH; Transcription factor MYB21
TrEMBLA0A0B2QQ121e-138A0A0B2QQ12_GLYSO; Transcription factor MYB21
STRINGGLYMA19G00930.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.13e-83myb domain protein 21
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]